BSU23520

BSU_23520

transcriptional repressor Fur family

transcriptional repressor [SW|Fur family]

BSU23520

BSU_23520

MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYLLVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECGAVDEIEEDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCNGKETE

[SW|acquisition of iron], [SW|iron metabolism], [SW|transcription factors and their control], [SW|glutamate metabolism]

2,449,841 -> 2,450,290

no growth with glucose and ammonium as single sources of carbon and nitrogen, respectively (due to [[protein|FsrA]]-mediated repression of the ''[[protein|gltA]]-[[protein|gltB]]'' operon) [Pubmed|22389480]

poor frowth on lactate as single carbon source (due to overexpression of [SW|FsrA]-mediated repression of the ''[[protein|lutA]]-[[protein|lutB]]-[[protein|lutC]]'' operon, can be suppressed by inactivation of ''[[protein|fsrA]]'' or ''[[protein|fbpB]]'') [Pubmed|22427629]

transcription profile of a ''[[protein|fur]]'' mutant strain: [http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE27416 GEO] [Pubmed|22389480]

no growth with glucose and ammonium as single sources of carbon and nitrogen, respectively (due to [[protein|FsrA]]-mediated repression of the ''[[gene|gltA]]-[[gene|gltB]]'' operon) [Pubmed|22389480]

poor growth on lactate as single carbon source (due to overexpression of [[protein|FsrA]]-mediated repression of the ''[[gene|lutA]]-[[gene|lutB]]-[[gene|lutC]]'' operon, can be suppressed by inactivation of ''[[gene|fsrA]]'' or ''[[gene|fbpB]]'') [Pubmed|22427629]

transcription profile of a ''[[gene|fur]]'' mutant strain: [http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE27416 GEO] [Pubmed|22389480]

[SW|Fur family]

[SW|Fur family] (according to UniProt)

[[protein|PerR]], [[protein|Zur]]

[[this]]

Fe(II)

Fe²⁺ [pubmed|28938859]

DNA binding activity (repression) is triggered by binding of Fe(II) [Pubmed|23057863]

DNA binding activity (repression) is triggered by binding of Fe²⁺ [Pubmed|23057863]

''fur'' [Pubmed|12029044]

[[protein|SigA]] [Pubmed|12029044]

repressed in the absence of hydrogen peroxide ([[protein|PerR]]) [Pubmed|12029044]

[[protein|PerR]]: transcription repression [Pubmed|12029044]

HB6543 (aphA3), available in the [SW|John Helmann] lab; also available in the [SW|Stülke] lab GP879 (''fur::mls'') and GP868 (''fur::mls'', ''perR::spc'')

1A910 ( ''fur''::''kan''), [Pubmed|12029044], available at [http://pasture.asc.ohio-state.edu/BGSC/getdetail.cfm?bgscid=1A910&Search=1A910 BGSC]

MGNA-C426 (yqkL::erm), available at the [https://shigen.nig.ac.jp/bsub/resource/strainGeneDisrupted/detail/2424 NBRP B. subtilis, Japan]

HB6543 (aphA3), available in the [SW|John Helmann]'s lab

GP879 (''fur::mls'') and GP868 (''fur::mls'', ''perR::spc''), available in the [SW|Jörg Stülke]'s lab

1A910 ( ''fur''::''kan''), [Pubmed|12029044], available at [http://pasture.asc.ohio-state.edu/BGSC/getdetail.cfm?bgscid=1A910&Search=1A910 BGSC]

BKE23520 (Δ[[gene|fur]]::erm trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKE23520 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATGTCTTTCCCTCCTACGC, downstream forward: _UP4_TAGACGGTGCCGAGCGCGAA

BKK23520 (Δ[[gene|fur]]::kan trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKK23520 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATGTCTTTCCCTCCTACGC, downstream forward: _UP4_TAGACGGTGCCGAGCGCGAA

[SW|John Helmann], Cornell University, USA [http://www.micro.cornell.edu/research/labs/helmann-lab/index.cfm Homepage]

15802251, 25209494, 25160631

15802251, 25209494, 25160631, 28938859

12374814, 12354229, 22389480, 21873409

12374814, 12354229, 22389480, 21873409, 29133393

18487332, 14563870, 18697947, 10400588, 11790741, 12207695, 9701813, 12029044, 22427629, 17725565, 17012385, 12950915, 19508286, 16672620, 23057863, 25486128

18487332, 14563870, 18697947, 10400588, 11790741, 12207695, 9701813, 12029044, 22427629, 17725565, 17012385, 12950915, 19508286, 16672620, 23057863, 25486128, 28439033, 29133393, 30377275, 22665794, 31988078, 32949815

149

450

2,449,841 → 2,450,290

[PDB|4ETS] (from Campylobacter jejuni, 33% identity) [pubmed|22665794]

[[this]]

[[this]]

[SW|John Helmann], Cornell University, USA [http://www.micro.cornell.edu/research/labs/helmann-lab/index.cfm Homepage]