DEAD-box RNA helicase, important for adaptation to low temperatures

DEAD-box RNA helicase

BSU39110

BSU_39110

BSU39110

BSU_39110

MSHFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGKTASFGIPLCELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSFDKQKAELKQKSHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTMLFSATLPQDIEKLSRQYMQNPEHIEVKAAGLTTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK

[SW|DEAD-box RNA helicases], [SW|translation]

4,015,987 -> 4,017,426

RNA helicase

required for [SW|ribosome] assembly [Pubmed|23175651]

RNA helicase

ATP + H₂O --> ADP + H⁺ + phosphate (according to UniProt)

[[DEAD-box RNA helicases|DEAD-box RNA helicase]]

[SW|helicase family] (according to UniProt)

[SW|DEAD-box RNA helicases] (according to UniProt)

[[protein|CshA]], [[protein|CshB]], [[protein|YfmL]]

[[this]]

Helicase domain 1: AS 1-203

Linker region: AS 204-212

Helicase domain 2: AS 207-368

RNA-binding domain: AS 404-479

[SW|Helicase ATP-binding domain] (aa 33-203) (according to UniProt)

[SW|Helicase C-terminal domain] (aa 214-374) (according to UniProt)

[PDB|2G0C] (RNA-binding domain, AA 404-479), [PDB|2HJV] (second domain, AA 207-368); [PDB|3MOJ] (RNA binding domain complexed with a fragment of 23S ribosomal RNA) [Pubmed|20673833]

[PDB|5IVL] (from Geobacillus stearothermophilus, corresponds to aa 1 ... 373, 44% identity) [pubmed|28238534]

[PDB|2G0C] (RNA-binding domain, AA 404-479)

[PDB|2HJV] (second domain, AA 207-368)

[PDB|3MOJ] (RNA binding domain complexed with a fragment of 23S ribosomal RNA) [Pubmed|20673833]

[[protein|DeaD]]-[[protein|CshA]] [Pubmed|20572937]

[[protein|DeaD]]-[[protein|CshB]] [Pubmed|20572937]

[[protein|DeaD]]-[SW|23S rRNA] [Pubmed|20673833]

''[[protein|yxiM]]-[[protein|deaD]]'' [Pubmed|10746760]

expression declines in the stationary phase [Pubmed|23175651]

GP1052 (tet), available in the [SW|Stülke] lab

MGNA-B720 (deaD::erm), available at the [https://shigen.nig.ac.jp/bsub/resource/strainGeneDisrupted/detail/1719 NBRP B. subtilis, Japan]

GP1052 (Δ[[gene|deaD]]::tet), available in [SW|Jörg Stülke]'s lab

BKE39110 (Δ[[gene|deaD]]::erm trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKE39110 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATGTATAAACTCCTGTCTC, downstream forward: _UP4_AAATGATGAATGACCTGCTC

BKK39110 (Δ[[gene|deaD]]::kan trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKK39110 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATGTATAAACTCCTGTCTC, downstream forward: _UP4_AAATGATGAATGACCTGCTC

for expression/ purification from ''B. subtilis'' with C-terminal Strep-tag, for [SW|SPINE], expression from the native chromomsomal site: GP1065 (spc), available in [SW|Jörg Stülke]'s lab

B. pertussis adenylate cyclase-based bacterial two hybrid system ([SW|BACTH]), available in [SW|Jörg Stülke]'s lab

B. pertussis adenylate cyclase-based bacterial two hybrid system ([SW|BACTH]), available in [SW|Jörg Stülke]'s lab, [pubmed|20572937]

[SW|Dagmar Klostermeier], Biozentrum Basel, Switzerland [http://www.biozentrum.unibas.ch/klostermeier/index.html homepage]

17142894, 16118224, 17229151, 16611943, 19839642, 19474341, 18184816, 17951299, 12460566, 10481020, 20572937, 20673833, 20691700, 23175651, 23625962, 25907111, 25123660

17142894, 16118224, 17229151, 16611943, 19839642, 19474341, 18184816, 17951299, 12460566, 10481020, 20572937, 20673833, 20691700, 23175651, 23625962, 25907111, 25123660, 28238534, 30337909

479

1440

4,015,987 → 4,017,426

[[this]]

[[this]]

for expression/ purification from ''B. subtilis'' with C-terminal Strep-tag, for [SW|SPINE], expression from the native chromomsomal site: GP1065 (spc), available in [SW|Jörg Stülke]'s lab

[SW|Dagmar Klostermeier], Biozentrum Basel, Switzerland [http://www.biozentrum.unibas.ch/klostermeier/index.html homepage]