maltose-specific phosphotransferase system, EIICB of the PTS

maltose-specific permease of the [SW|phosphotransferase systems|phosphotransferase system], EIICB of the [[category|Phosphotransferase system|PTS]]

BSU08200

BSU_08200

maltose-specific phosphotransferase system, EIICB

maltose-specific [[category|Phosphotransferase system|PTS]], EIICB

BSU08200

BSU_08200

MMQKIQRFGSAMFVPVLLFAFAGIIVGISTLFKNKTLMGPLADPDGFWYQCWYIIEQGGWTVFNQMPLLFAIGIPVALAKKAQARACLEALTVYLTFNYFVSAILTVWGGAFGVDMNQEVGGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFDKKLPDFLGIFQGSTYIVMISFFIMIPIALAVSYIWPMVQSGIGSLQSFLVASGAVGVWIYTFLERILIPTGLHHFIYTPFIYGPAVAEGGIVTYWAQHLGEYSQSAKPLKELFPQGGFALHGNSKIFGIPGIALAFYVTAKKEKKKLVAGLLIPVTLTAIVAGITEPIEFTFLFISPFLFAVHAVLAATMSTVMYMAGVVGNMGGGLIEAVTLNWIPLFGSHGMTYVYQILIGLSFTAIYFFVFRFLILKFNIATPGREKDEQQETKLYSKKEYRERKNKDETASAAETADDTAFLYIEALGGKDNITEVTNCATRLRVSVKDETKVEPDSVFRALGAHGVVRNGKAFQVIIGLSVPQMRERVEKILNQ

[SW|phosphotransferase systems], [SW|utilization of specific carbon sources], [SW|membrane proteins], [SW|phosphoproteins]

892,215 -> 893,798

Protein EIIB N(pi)-phospho-L-histidine/cysteine + sugar = protein EIIB + sugar phosphate (according to Swiss-Prot)

D-maltose + N^π-phospho-L-histidyl-[protein] --> α-maltose 6'-phosphate + L-histidyl-[protein] (according to UniProt)

[SW|PTS] permease, glucose permease (Glc) family [Pubmed|10627040]

[[category|Phosphotransferase system|PTS]] permease, glucose family [Pubmed|10627040]

cell membrane (according to Swiss-Prot)

cell membrane (according to UniProt)

''[[protein|malA]]-[[protein|glvR]]-[[protein|malP]]'' [Pubmed|11489864]

[[protein|SigA]] [Pubmed|11489864]

induction by maltose ([[protein|GlvR]]) [Pubmed|11489864]

repressed by glucose ([[protein|CcpA]]) [Pubmed|11489864]

[[protein|GlvR]]: transcription activation [Pubmed|11489864]

[[protein|CcpA]]: transcription repression [Pubmed|11489864]

GP110 (spc), available in [SW|Stülke] lab

MGNA-C291 (glvC::erm), available at the [https://shigen.nig.ac.jp/bsub/resource/strainGeneDisrupted/detail/2289 NBRP B. subtilis, Japan]

GP110 (spc), available in [SW|Stülke] lab

BKE08200 (Δ[[gene|malP]]::erm trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKE08200 BGSC], [Pubmed|28189581], upstream reverse: _UP1_TTGCATCATACCAGAACCCC, downstream forward: _UP4_TAAAGACTGCCCTCCTTTTC

BKK08200 (Δ[[gene|malP]]::kan trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKK08200 BGSC], [Pubmed|28189581], upstream reverse: _UP1_TTGCATCATACCAGAACCCC, downstream forward: _UP4_TAAAGACTGCCCTCCTTTTC

16707683, 10627040, 11489864

16707683, 10627040, 11489864, 30038046, 29784777

527

1584

892,215 → 893,798

[[this]]

[SW|PTS EIIB domain] type-1 (aa 449–527) (according to UniProt)

[SW|PTS EIIC domain] type-1 (aa 1-418) (according to UniProt)

[PDB|6BVG] (EIIC domain from B. cereus, corresponds to aa 6 - 419, 27% identity) [pubmed|29784777]

[[this]]

[[this]]