mediator of RecA binding to ssDNA, required for the formation of RecA DNA repair centers, required for efficient survival and replication restart after replication-transcription conflicts

mediator of [[protein|RecA]] binding to ssDNA, required for the formation of [[protein|RecA]] DNA repair centers, required for efficient survival and replication restart after replication-transcription conflicts

BSU25280

BSU_25280

mediator of RecA binding to ssDNA

mediator of [[protein|RecA]] binding to ssDNA

BSU25280

BSU_25280

MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLMQKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEEKKPNPYLFEFILESLKQLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEKDPYRIPIKPQTARLLRLFYYFDLSRLGNVSLKEETKAELKQVIDLYYEEYSGLYLKSKRFLDQMESMKHLMGENKS

[SW|DNA repair/ recombination]

2,608,946 -> 2,609,713

drastically reduced survival of mature dormant spores after exposure to ultrahigh vacuum desiccation and ionizing radiation that induce single strand (ss) DNA nicks and double-strand breaks (DSBs) [Pubmed|24285298]

''[[protein|recO]] [[protein|recJ]]'' double mutants are extremely sensitive against DNA damaging agents [Pubmed|26001966]

''[[protein|recO]] [[protein|dprA]]'' double mutants have a strongly reduced chromosomal transformation rate [Pubmed|23779106,22373918]

''[[protein|recO]] [[protein|addA]]-[[protein|addB]]'' double mutants are extremely sensitive against DNA damaging agents [Pubmed|26001966]

drastically reduced survival of mature dormant spores after exposure to ultrahigh vacuum desiccation and ionizing radiation that induce single strand (ss) DNA nicks and double-strand breaks (DSBs) [Pubmed|24285298]

''[[gene|recO]] [[gene|recJ]]'' double mutants are extremely sensitive against DNA damaging agents [Pubmed|26001966]

''[[gene|recO]] [[gene|dprA]]'' double mutants have a strongly reduced chromosomal transformation rate [Pubmed|23779106,22373918]

''[[gene|recO]] [[gene|addA]]-[[gene|addB]]'' double mutants are extremely sensitive against DNA damaging agents [Pubmed|26001966]

reduced viability of a [[gene|rarA]] [[gene|recO]] double mutant [pubmed|32117122]

suppression of lethality of [[gene|pcrA]] inactivation [pubmed|32793628]

provides [[protein|RecA]] access to ssDNA during chromosomal transformation (together with [[protein|DprA]]) [Pubmed|22373918]

catalyzes annealing of [[protein|SsbA]] or [[protein|SsbA]]/[[protein|SsbB]] coated ssDNAs to allow the formation of DNA duplexes with tails during plasmid transformation [Pubmed|22373918]

required for the formation of [[protein|RecA]] DNA repair centers (together with [[protein|RecR]]) [Pubmed|24891441]

provides [[protein|RecA]] access to ssDNA during chromosomal transformation (together with [[protein|DprA]]) [Pubmed|22373918]

catalyzes annealing of [[protein|SsbA]] or [[protein|SsbA]]/[[protein|SsbB]] coated ssDNAs to allow the formation of DNA duplexes with tails during plasmid transformation [Pubmed|22373918]

required for the formation of [[protein|RecA]] DNA repair centers (together with [[protein|RecR]]) [Pubmed|24891441]

anneals [[protein|SsbA]]- or [[protein|SsbB]]-coated complementary strands of transfecting SPP1 phage DNA, yielding tailed SPP1 duplex intermediates [pubmed|31876108]

[[protein|DprA]], [[protein|RecO]] or viral single strand annealing G35P protein, may catalyze the annealing of complete linear phage genomes with redundant regions at the ends of the molecule, alone or with the help of an exonuclease, to produce a circular unit-length duplex viral genome ready to initiate replication [pubmed|31876108]

recO family (according to Swiss-Prot)

recO family (single member, according to UniProt)

[[protein|SsbA]] (bound to ssDNA) -[[protein|RecO]], this helps to dislodge [[protein|SsbA]] and [[protein|SsbB]] from ssDNA [Pubmed|21170359,22373918]

[[protein|RecR]]-[[protein|RecO]], [[protein|RecR]]:[[protein|RecO]] molecular ratio of 2:1 (as judged from other bacteria such as ''E. coli'' and ''Deinococcus radiodurans'') [Pubmed|17581636]

1A892 ( ''recO''::''cat''), [Pubmed|10323239], available at [http://pasture.asc.ohio-state.edu/BGSC/getdetail.cfm?bgscid=1A892&Search=1A892 BGSC]

BKE25280 ( ''recO''::''ermC''), (available at the [http://www.bgsc.org/ BGSC] and in [SW|Fabian Commichau]'s lab)

BP738 ( ''recO''::''tet''), (available in [SW|Fabian Commichau]'s lab)

BP774 ( ''recO''::''ermC''), (available in [SW|Fabian Commichau]'s lab)

GP3527 (Δ[[gene|recO]]::kan), available in [SW|Jörg Stülke]'s lab

MGNA-C494 (yqxN::erm), available at the [https://shigen.nig.ac.jp/bsub/resource/strainGeneDisrupted/detail/2492 NBRP B. subtilis, Japan]

1A892 ( ''recO''::''cat''), [Pubmed|10323239], available at [http://pasture.asc.ohio-state.edu/BGSC/getdetail.cfm?bgscid=1A892&Search=1A892 BGSC]

BG128 (Δ[[gene|recO]]::cat), available in [SW|Juan Alonso]'s and [SW|Jörg Stülke]'s labs [pubmed|9642195]

BP738 ( Δ''recO''::''tet''), (available in [SW|Fabian Commichau]'s lab)

BP774 ( Δ''recO''::''ermC''), (available in [SW|Fabian Commichau]'s lab)

BKE25280 (Δ[[gene|recO]]::erm trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKE25280 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATTTCCGCACCTTCCTCAA, downstream forward: _UP4_TGACATTTGGTCCATCTTTT

BKK25280 (Δ[[gene|recO]]::kan trpC2) available at [http://www.bgsc.org/getdetail.php?bgscid=BKK25280 BGSC], [Pubmed|28189581], upstream reverse: _UP1_CATTTCCGCACCTTCCTCAA, downstream forward: _UP4_TGACATTTGGTCCATCTTTT

22933559

22933559, 32286623

24891441, 18599486, 19730681, 20581116, 22373918, 17581636, 21170359, 24285298, 24285298, 25939832, 26001966, 15186413, 10323239, 26786319, 23779106

24891441, 18599486, 19730681, 20581116, 22373918, 17581636, 21170359, 24285298, 24285298, 25939832, 26001966, 15186413, 10323239, 26786319, 23779106, 30401797, 31876108, 32117122, 32793628

255

768

2,608,946 2,609,713

[[this]]

[[this]]

[[this]]