SubtiBank SubtiBank
Version comparison:

Wed Dec 21 2016 17:19:27 GMT+0100 (CET)Thu Oct 01 2015 13:51:44 GMT+0200 (CEST)

Expression and Regulation

Regulation

induced in the presence of guanidine ([SW|ykkC riboswitch]) [Pubmed|27989440]

Expression and Regulation

Regulatory mechanism

[SW|ykkC riboswitch]: binding of the ligand guanidine causes transcriptional antitermination [Pubmed|27989440]

term-seq has identified a potential novel regulatory RNA element including an intrinsic transcription terminator upstream of ''ykkC'' [Pubmed|27120414]

expression of the ''[[protein|ykkC]]-[[protein|ykkD]]'' operon may be controlled by the presumptive ''[[protein|ykkC]]''/''[[protein|yxkD]]'' [SW|riboswitch] [Pubmed|15096624]

term-seq has identified a potential novel regulatory RNA element including an intrinsic transcription terminator upstream of ''ykkC'' [Pubmed|27120414]

Biological materials

Mutant

MGNA-A747 (ykkC::erm), available at the [https://shigen.nig.ac.jp/bsub/resource/strainGeneDisrupted/detail/747 NBRP B. subtilis, Japan]

References

15096624, 10735877, 21317561, 27120414, 27989440

15096624, 10735877, 21317561, 27120414

aminos

MKWGLVVLAAVFEVVWVIGLKHADSALTWSGTAIGIIFSFYLLMKATHSLPVGTVYAVFTGLGTAGTVLSEIVLFHEPVGWPKLLLIGVLLIGVIGLKLVTQDETEEKGGEA